PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G06870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 370aa    MW: 40874.2 Da    PI: 9.8856
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G06870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.45.5e-072322771762
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      A+rsR RK+++i+eLe+kv++L++e  +   e+e l+++   l+ e
  OPUNC11G06870.1 232 AQRSRVRKLQYIAELERKVQALQSEGIDVSAEMEFLSQQNIMLDLE 277
                      89***********************999999999888887666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-5221280IPR004827Basic-leucine zipper domain
CDDcd147032.00E-15222272No hitNo description
SuperFamilySSF579596.88E-6231274No hitNo description
Gene3DG3DSA:1.20.5.1708.9E-6232274No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MMMANAKLPK QALLPPRSPF PTAGAAPYAG DHGPIARPQG APHHRHGHGH GHGHGHHQRT  60
SSESFIEEQP SWLDDLLNEP ETPVRQHGRA GHRRSSSDSF ALFDGGAATG AYANGFEGMG  120
GGGGQAAPWG GVQEYYAKPG SFGRHQGRPW EQGMNNLVNY RQGGGPPMPA KEKVGGHHGS  180
ASVLRDHDHG MDRRSSDESG HDQKVGAERK EGVPPKHAQS EADTKRAKQQ YAQRSRVRKL  240
QYIAELERKV QALQSEGIDV SAEMEFLSQQ NIMLDLENKA LKQRLESLAQ EQLIKRFQQE  300
MFEREIGRLR SLYQQQQQQQ KQPQPTTTLS RSNSRDLDSQ FANLSLKHKD PNSGRDAISG  360
PLRTQSSSIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0722670.0AK072267.1 Oryza sativa Japonica Group cDNA clone:J023004I18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662832.20.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A0E0MDX10.0A0A0E0MDX1_ORYPU; Uncharacterized protein
STRINGOB11G15450.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-70bZIP family protein